• USA:

Recombinant Macaca mulatta (Rhesus macaque) Interleukin-10 (IL10)

  • SPECIFICATION
  • Cat No. PPD1515
Product Name Recombinant Macaca mulatta (Rhesus macaque) Interleukin-10 (IL10)
Unit Size 1mg/100 μg/20 μg
Form Lyophilized
Feature Protein length: 19-178 aa
Molecular weight: 22.7 kDa
Amino acid sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Species Reactivity Macaca mulatta
Class Recombinant protein
Conjugate N-terminal 10xHis-tagged and C-terminal myc-tagged
Purification Affinity chromatography
Storage Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Storage temp Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Please note that all products/services provided are for research use only. Not intended for any clinical use.
Online Inquiry